Loading...
Statistics
Advertisement

www.asiachart.ru обслуживается хостингом ÑÐ°Ð¹Ñ ...
www.asiachart.ru/

Asiachart.ru

Advertisement
Conversion Technology Metas Server
Asiachart.ru is hosted in Germany . Asiachart.ru uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Google Font API, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Asiachart.ru

Technology

Number of occurences: 4
  • CSS
  • Google Font API
  • Html
  • Php

Advertisement

Server Type

  • Apache

Powered by

  • PHP/5.4.45

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Asiachart.ru

SSL certificate

    • name: /CN=*.shneider-host.ru
    • subject:
      • CN: *.shneider-host.ru
    • hash: c169d423
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G3
    • version: 2
    • serialNumber: 602447
    • validFrom: 151224092031Z
    • validTo: 170124215047Z
    • validFrom_time_t: 1450948831
    • validTo_time_t: 1485294647
    • extensions:
      • authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
      • authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.shneider-host.ru, DNS:shneider-host.ru
      • crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal

Meta - Asiachart.ru

Number of occurences: 1
  • Name:
    Content:

Server / Hosting

  • IP: 144.76.218.198
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • ns8.host1plus.com
  • ns9.host1plus.com
  • mail.asiachart.ru

Target

  • postmaster.ns8.host1plus.com

HTTP Header Response

HTTP/1.1 200 OK Date: Wed, 28 Sep 2016 05:11:56 GMT Server: Apache X-Powered-By: PHP/5.4.45 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_wx1113 Transfer-Encoding: chunked Via: 1.1 s_wx1113 (squid/3.5.20) Connection: keep-alive

DNS

host: asiachart.ru
  1. class: IN
  2. ttl: 21600
  3. type: A
  4. ip: 144.76.218.198
host: asiachart.ru
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns8.host1plus.com
host: asiachart.ru
  1. class: IN
  2. ttl: 21600
  3. type: NS
  4. target: ns9.host1plus.com
host: asiachart.ru
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns8.host1plus.com
  5. rname: postmaster.ns8.host1plus.com
  6. serial: 2016012700
  7. refresh: 28800
  8. retry: 7200
  9. expire: 2419200
  10. minimum-ttl: 86400
host: asiachart.ru
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mail.asiachart.ru

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.siachart.ru, www.aosiachart.ru, www.osiachart.ru, www.apsiachart.ru, www.psiachart.ru, www.a9siachart.ru, www.9siachart.ru, www.asiachart.ru, www.siachart.ru, www.aisiachart.ru, www.isiachart.ru, www.ausiachart.ru, www.usiachart.ru, www.aiachart.ru, www.aseiachart.ru, www.aeiachart.ru, www.aswiachart.ru, www.awiachart.ru, www.asdiachart.ru, www.adiachart.ru, www.asxiachart.ru, www.axiachart.ru, www.asfiachart.ru, www.afiachart.ru, www.asgiachart.ru, www.agiachart.ru, www.astiachart.ru, www.atiachart.ru, www.asachart.ru, www.asirachart.ru, www.asrachart.ru, www.asifachart.ru, www.asfachart.ru, www.asivachart.ru, www.asvachart.ru, www.asikachart.ru, www.askachart.ru, www.asi,achart.ru, www.as,achart.ru, www.asibachart.ru, www.asbachart.ru, www.asigachart.ru, www.asgachart.ru, www.asitachart.ru, www.astachart.ru, www.asiyachart.ru, www.asyachart.ru, www.asiuachart.ru, www.asuachart.ru, www.asijachart.ru, www.asjachart.ru, www.asimachart.ru, www.asmachart.ru, www.asinachart.ru, www.asnachart.ru, www.asichart.ru, www.asiaochart.ru, www.asiochart.ru, www.asiapchart.ru, www.asipchart.ru, www.asia9chart.ru, www.asi9chart.ru, www.asiachart.ru, www.asichart.ru, www.asiaichart.ru, www.asiichart.ru, www.asiauchart.ru, www.asiuchart.ru, www.asiahart.ru, www.asiacdhart.ru, www.asiadhart.ru, www.asiacrhart.ru, www.asiarhart.ru, www.asiacthart.ru, www.asiathart.ru, www.asiacvhart.ru, www.asiavhart.ru, www.asiacfhart.ru, www.asiafhart.ru, www.asiacghart.ru, www.asiaghart.ru, www.asiachhart.ru, www.asiahhart.ru, www.asiacnhart.ru, www.asianhart.ru, www.asiacmhart.ru, www.asiamhart.ru, www.asiacjhart.ru, www.asiajhart.ru, www.asiacart.ru, www.asiacheart.ru, www.asiaceart.ru, www.asiachdart.ru, www.asiacdart.ru, www.asiachcart.ru, www.asiaccart.ru, www.asiachuart.ru, www.asiacuart.ru, www.asiachjart.ru, www.asiacjart.ru, www.asiachart.ru, www.asiacart.ru, www.asiachbart.ru, www.asiacbart.ru, www.asiachgart.ru, www.asiacgart.ru, www.asiachrt.ru, www.asiachaort.ru, www.asiachort.ru, www.asiachaprt.ru, www.asiachprt.ru, www.asiacha9rt.ru, www.asiach9rt.ru, www.asiachart.ru, www.asiachrt.ru, www.asiachairt.ru, www.asiachirt.ru, www.asiachaurt.ru, www.asiachurt.ru, www.asiacharit.ru, www.asiachait.ru, www.asiacharot.ru, www.asiachaot.ru, www.asiacharlt.ru, www.asiachalt.ru, www.asiacharlt.ru, www.asiachalt.ru, www.asiachar.t.ru, www.asiacha.t.ru, www.asiachar.ru, www.asiachartq.ru, www.asiacharq.ru, www.asiacharta.ru, www.asiachara.ru, www.asiachart .ru, www.asiachar .ru, www.asiachartw.ru, www.asiacharw.ru, www.asiacharte.ru, www.asiachare.ru, www.asiachartz.ru, www.asiacharz.ru, www.asiachartx.ru, www.asiacharx.ru, www.asiachartc.ru, www.asiacharc.ru,

Other websites we recently analyzed

  1. Doug Rommel's Pool Service
    Lansing (United States) - 50.28.24.255
    Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  2. usbaring.com
    Sunnyvale (United States) - 67.195.61.46
    Server software: ATS/5.0.1
    Technology: Html
    Number of Javascript: 1
    Number of meta tags: 1
  3. Errenkoalde - Hasiera
    Spain - 212.142.226.114
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery UI, PageSpeed Module, Php, Joomla, Twitter Button
    Number of Javascript: 11
    Number of meta tags: 5
  4. bellcellphones.com
    Road Town (Virgin Islands, British) - 208.91.196.52
    Server software: Microsoft-IIS/8.5
    Technology: Html
    Number of meta tags: 2
  5. jyvaskylanhammaslaakariasema.fi
    Finland - 217.149.52.104
    Server software: Apache/2.4.10 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  6. blacksheephdfc.com
    Los Angeles (United States) - 74.124.205.131
    Server software: Apache/2
    Technology: Html
  7. Ben Ravilious - photographs and images of Leicester Singapore Devon
    Photographs of the city of Leicester. Also images of North Devon and Singapore, leicester photos, leicester photographs, leicester photographer, leicester images, leicester pictures, singapore photos, singapore photographs, singapore photographer, singapore images, singapore pictures, photos of leicester, photographs of leicester, images of leicester, pictures of leicester, leicester town hall
    Dublin (Ireland) - 52.17.153.21
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Javascript
    Number of Javascript: 1
    Number of meta tags: 12
  8. www.monkeytail.org
    San Francisco (United States) - 192.0.78.24
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress, Twitter Button
    Number of Javascript: 6
    Number of meta tags: 9
  9. Lopez Taibo - Proximamente
    Overland Park (United States) - 69.64.95.53
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. Home
    Scottsdale (United States) - 107.180.44.132
    Server software: Apache/2.4.16
    Technology: CSS, Html, Html5, Javascript, jQuery
    Number of Javascript: 5
    Number of meta tags: 6

Check Other Websites